CacheBy
Atlas Antibodies Anti-MED28 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MED28 Antibody

상품 한눈에 보기

인간 MED28 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 WB에 적합하며, 토끼 유래 IgG 형식으로 높은 종간 반응성을 보임. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공.

카탈로그번호
HPA035900-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035900-100 Anti-MED28 Antibody, mediator complex subunit 28 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035900-25 Anti-MED28 Antibody, mediator complex subunit 28 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MED28 Antibody

Anti-MED28 Antibody

Target Information

  • Target Protein: Mediator complex subunit 28
  • Target Gene: MED28
  • Alternative Gene Names: DKFZP434N185, EG1, magicin
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human MED28.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000003592 96%
Mouse ENSMUSG00000015804 94%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.