CacheBy
Thermo Fisher Scientific Staufen Polyclonal Antibody
원본

Thermo Fisher Scientific Staufen Polyclonal Antibody

상품 한눈에 보기

Staufen 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Western blot에 적합합니다. 인간 및 랫트 반응성을 가지며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 06:17
Thermo Fisher Scientific PA580077 Staufen Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific Staufen Polyclonal Antibody

Applications

  • Western Blot (WB): 0.1–0.5 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Staufen (532–568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2747192

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

STAU1은 이중가닥 RNA(dsRNA) 결합 단백질 계열에 속하며, mRNA를 다양한 세포 소기관으로 운반하거나 위치시키는 데 관여합니다. 여러 dsRNA 결합 도메인을 포함하며, 이들은 이중가닥 구조를 가진 RNA와 결합하는 데 필요합니다. 인간 STAU1은 미세소관 결합 도메인을 포함하고 있으며, tubulin과 결합합니다. 또한 STAU1은 거친 소포체(RER)와 연관된 세포질에서 발견되어, 미세소관 네트워크를 통해 mRNA를 RER로 운반하는 역할을 합니다. STAU1은 인플루엔자 리보핵단백질(NS1, NP, PA)과 상호작용하며, 효율적인 바이러스 복제에 필수적입니다.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.