CacheBy
Atlas Antibodies Anti-MED18 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MED18 Antibody

상품 한눈에 보기

Human MED18 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit 호스트에서 생산되었으며 IgG 아이소타입을 가집니다. PrEST 항원을 이용해 친화 정제되었으며 높은 종간 반응성을 보입니다.

카탈로그번호
HPA027429-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027429-100 Anti-MED18 Antibody, mediator complex subunit 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027429-25 Anti-MED18 Antibody, mediator complex subunit 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MED18 Antibody

Anti-MED18 Antibody

Target Information

  • Target Protein: Mediator complex subunit 18
  • Target Gene: MED18
  • Alternative Gene Names: FLJ20045, p28b
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MED18.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RARRSMDRAGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGH

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000047303 100%
Mouse ENSMUSG00000066042 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.