CacheBy
Atlas Antibodies Anti-ME3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ME3 Antibody

상품 한눈에 보기

Human ME3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증된 고품질 항체입니다. PrEST 항원을 이용해 친화 정제되었으며, PBS/glycerol buffer에 보존됩니다.

카탈로그번호
HPA038473-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038473-100 Anti-ME3 Antibody, malic enzyme 3, NADP(+)-dependent, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038473-25 Anti-ME3 Antibody, malic enzyme 3, NADP(+)-dependent, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ME3 Antibody

Anti-ME3 Antibody

Target: malic enzyme 3, NADP(+)-dependent, mitochondrial
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human ME3

Open Datasheet


Target Information

항목 내용
Target Protein malic enzyme 3, NADP(+)-dependent, mitochondrial
Target Gene ME3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV
Verified Species Reactivity Human
Interspecies Identity Mouse (87%), Rat (76%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage & Handling Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Safety Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.