Atlas Antibodies Anti-MECR Antibody

상품 한눈에 보기

Human MECR 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립 항체 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며, Rat 및 Mouse에 높은 유사성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028740-100 Anti-MECR Antibody, mitochondrial trans-2-enoyl-CoA reductase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028740-25 Anti-MECR Antibody, mitochondrial trans-2-enoyl-CoA reductase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: mitochondrial trans-2-enoyl-CoA reductase (MECR)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.

CGI-63, FASN2B, NRBF1

항목	내용
Target Protein	mitochondrial trans-2-enoyl-CoA reductase
Target Gene	MECR
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	SDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCV
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000028047 (86%), Mouse ENSMUSG00000028910 (85%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand