CacheBy
Atlas Antibodies Anti-MECR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MECR Antibody

상품 한눈에 보기

인간 MECR 단백질을 인식하는 폴리클로날 항체로, IHC와 WB에서 독립적 검증을 완료한 고품질 제품입니다. Rabbit 호스트에서 생산되었으며, PrEST 항원 기반으로 친화 정제되었습니다. 인간에 높은 반응성을 보이며, 안정적인 PBS/glycerol 버퍼에 보존됩니다.

카탈로그번호
HPA022030-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA022030-100 Anti-MECR Antibody, mitochondrial trans-2-enoyl-CoA reductase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022030-25 Anti-MECR Antibody, mitochondrial trans-2-enoyl-CoA reductase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MECR Antibody

Anti-MECR Antibody

Target: mitochondrial trans-2-enoyl-CoA reductase
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human MECR

Alternative Gene Names

CGI-63, FASN2B, NRBF1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein mitochondrial trans-2-enoyl-CoA reductase
Target Gene MECR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (86%), Mouse (85%)

Antigen Sequence:

SDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.