CacheBy
Atlas Antibodies Anti-MECR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-MECR Antibody

상품 한눈에 보기

Human MECR 단백질을 타겟으로 한 Rabbit Polyclonal 항체. IHC 및 WB에서 독립 항체 검증 완료. PrEST 항원을 이용한 친화 정제. 높은 종간 보존성(쥐 86%, 생쥐 85%) 확인. PBS/glycerol buffer에 보존제 포함.

카탈로그번호
HPA022018-xxx (2개 옵션)
브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA022018-100 Anti-MECR Antibody, mitochondrial trans-2-enoyl-CoA reductase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022018-25 Anti-MECR Antibody, mitochondrial trans-2-enoyl-CoA reductase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MECR Antibody

Anti-MECR Antibody

Target: mitochondrial trans-2-enoyl-CoA reductase (MECR)
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against human MECR.

Alternative Gene Names

CGI-63, FASN2B, NRBF1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein mitochondrial trans-2-enoyl-CoA reductase
Target Gene MECR
Verified Species Reactivity Human
Interspecies Identity Rat (86%), Mouse (85%)

Antigen Information

Antigen Sequence (PrEST):
SDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCV

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Validation
WB Validation

Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-MECR Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-MECP2 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-MECOM Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-ME2 Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.