CacheBy
Atlas Antibodies Anti-MCUB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MCUB Antibody

상품 한눈에 보기

인간 MCUB 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 정교한 단백질 발현 검증에 적합합니다. Rabbit 유래 IgG, PrEST 항원으로 정제되었으며 휴먼 반응성이 검증되었습니다.

카탈로그번호
HPA048776-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048776-100 Anti-MCUB Antibody, mitochondrial calcium uniporter dominant negative beta subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048776-25 Anti-MCUB Antibody, mitochondrial calcium uniporter dominant negative beta subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCUB Antibody

Anti-MCUB Antibody

mitochondrial calcium uniporter dominant negative beta subunit

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human MCUB

Alternative Gene Names

CCDC109B, FLJ20647

Open Datasheet

Target Information

항목 내용
Target Protein mitochondrial calcium uniporter dominant negative beta subunit
Target Gene MCUB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSE
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000027994 (75%), Rat ENSRNOG00000009433 (74%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.