CacheBy
Atlas Antibodies Anti-MCTP1 Antibody
원본

Atlas Antibodies Anti-MCTP1 Antibody

상품 한눈에 보기

Human MCTP1 단백질을 표적으로 하는 고품질 폴리클로날 항체. Rabbit에서 생산된 IgG 형식으로 IHC 및 ICC 응용에 적합. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human, Mouse, Rat 간 교차 반응성 확인됨.

카탈로그번호
HPA019018-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019018-100 Anti-MCTP1 Antibody, multiple C2 domains, transmembrane 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019018-25 Anti-MCTP1 Antibody, multiple C2 domains, transmembrane 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCTP1 Antibody

Anti-MCTP1 Antibody

Target: multiple C2 domains, transmembrane 1
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MCTP1.

Alternative Gene Names

  • FLJ22344

Open Datasheet

Target Information

  • Target Protein: multiple C2 domains, transmembrane 1
  • Target Gene: MCTP1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTLTLKDPHYPDHDLGIILLSVILTPKEGESRDVTMLMRKSWKRSSKFQTQSLRLSDLHRKSHLWRGIVSITLIEGRDLKAMDSNGLSDPYVKFRLGH

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000021596 98%
Rat ENSRNOG00000013282 98%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.