CacheBy
Atlas Antibodies Anti-MCRS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MCRS1 Antibody

상품 한눈에 보기

Human MCRS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, Human, Mouse, Rat에서 반응성이 검증되었습니다. 안정한 PBS/glycerol buffer에 보존됩니다.

카탈로그번호
HPA039057-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039057-100 Anti-MCRS1 Antibody, microspherule protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039057-25 Anti-MCRS1 Antibody, microspherule protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCRS1 Antibody

Anti-MCRS1 Antibody

Target: microspherule protein 1 (MCRS1)
Type: Polyclonal Antibody against Human MCRS1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human MCRS1 (microspherule protein 1).


Alternative Gene Names

ICP22BP, INO80Q, MCRS2, MSP58, P78

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein microspherule protein 1
Target Gene MCRS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
HPDAFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDLIDDSKLKDMRDEVLEHELMVADRRQKREIRQLEQELHKWQVLVD


Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000037570 (99%)
  • Rat ENSRNOG00000054838 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.