CacheBy
Atlas Antibodies Anti-MBLAC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MBLAC2 Antibody

상품 한눈에 보기

인간 MBLAC2 단백질을 인식하는 토끼 유래 폴리클로날 IgG 항체로, IHC 및 WB 분석에 적합. Orthogonal validation으로 단백질 발현 검증. PrEST 항원으로 친화 정제되었으며, 높은 종간 서열 일치도를 보유.

카탈로그번호
HPA060264-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060264-100 Anti-MBLAC2 Antibody, metallo-beta-lactamase domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060264-25 Anti-MBLAC2 Antibody, metallo-beta-lactamase domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MBLAC2 Antibody

Anti-MBLAC2 Antibody

metallo-beta-lactamase domain containing 2


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)

Orthogonal validation:
Protein expression validated by WB comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human MBLAC2


Alternative Gene Names

  • DKFZp686P15118
  • MGC46734

Open Datasheet


Target Information

항목 내용
Target Protein metallo-beta-lactamase domain containing 2
Target Gene MBLAC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RGDNFETVTWLSDSEVVRAPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLI
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000016252 (99%), Mouse ENSMUSG00000051098 (99%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.