Atlas Antibodies Anti-MBLAC2 Antibody

상품 한눈에 보기

Human MBLAC2 단백질을 인식하는 고품질 Rabbit Polyclonal 항체. IHC 및 WB(Orthogonal validation) 실험에 적합. PrEST 항원 기반 Affinity 정제. 인간 및 설치류 간 높은 서열 동일성(99%) 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037758-100 Anti-MBLAC2 Antibody, metallo-beta-lactamase domain containing 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037758-25 Anti-MBLAC2 Antibody, metallo-beta-lactamase domain containing 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

metallo-beta-lactamase domain containing 2

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Polyclonal Antibody against Human MBLAC2

DKFZp686P15118, MGC46734

항목	내용
Target Protein	metallo-beta-lactamase domain containing 2
Target Gene	MBLAC2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000016252 (99%), Mouse ENSMUSG00000051098 (99%)

Antigen Sequence:

RGDNFETVTWLSDSEVVRAPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLI

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand