Atlas Antibodies Anti-MBLAC2 Antibody

상품 한눈에 보기

Human MBLAC2 단백질을 인식하는 폴리클로날 항체로, WB 및 IHC에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 보존성과 정제 품질을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037757-100 Anti-MBLAC2 Antibody, metallo-beta-lactamase domain containing 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037757-25 Anti-MBLAC2 Antibody, metallo-beta-lactamase domain containing 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

metallo-beta-lactamase domain containing 2

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Polyclonal antibody against Human MBLAC2.

항목	내용
Target Protein	metallo-beta-lactamase domain containing 2
Target Gene	MBLAC2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RGDNFETVTWLSDSEVVRAPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLI
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000051098 (99%), Rat ENSRNOG00000016252 (99%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand