CacheBy
Atlas Antibodies Anti-MARC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MARC1 Antibody

상품 한눈에 보기

인간 MARC1 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 글리세롤 및 PBS 버퍼에 보존되어 안정적 사용 가능. 인간에 대한 반응성 검증 완료.

카탈로그번호
HPA028702-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028702-100 Anti-MARC1 Antibody, mitochondrial amidoxime reducing component 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028702-25 Anti-MARC1 Antibody, mitochondrial amidoxime reducing component 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MARC1 Antibody

Anti-MARC1 Antibody

Target: mitochondrial amidoxime reducing component 1 (MARC1)
Type: Polyclonal Antibody against Human MARC1


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human mitochondrial amidoxime reducing component 1 (MARC1).


Alternative Gene Names

FLJ22390, MOSC1

Open Datasheet


Target Information

항목 내용
Target Protein mitochondrial amidoxime reducing component 1
Target Gene MARC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGC

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000026621 79%
Rat ENSRNOG00000004101 74%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.