Atlas Antibodies Anti-MARCH2 Antibody

상품 한눈에 보기

Human MARCH2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종 간 보존성(88%)을 보입니다. PBS와 glycerol buffer에 보존된 고품질 연구용 시약입니다.

카탈로그번호: HPA014063-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA014063-100 Anti-MARCH2 Antibody, membrane-associated ring finger (C3HC4) 2, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA014063-25 Anti-MARCH2 Antibody, membrane-associated ring finger (C3HC4) 2, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MARCH2 Antibody

Anti-MARCH2 Antibody

membrane-associated ring finger (C3HC4) 2, E3 ubiquitin protein ligase

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

Polyclonal Antibody against Human MARCH2

Alternative Gene Names

HSPC240, MARCH-II, RNF172

Open Datasheet

Target Protein

membrane-associated ring finger (C3HC4) 2, E3 ubiquitin protein ligase

Target Gene

MARCH2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000079557 (88%)
Rat ENSRNOG00000007769 (88%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand