
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAPT Antibody
상품 한눈에 보기
Human MAPT 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤 및 PBS 완충액에 보존됩니다. 타우 단백질 연구 및 신경퇴행성 질환 연구에 유용합니다.
- 카탈로그번호
- HPA048895-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048895-100 Anti-MAPT Antibody, microtubule-associated protein tau 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048895-25 Anti-MAPT Antibody, microtubule-associated protein tau 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAPT Antibody
Anti-MAPT Antibody
Target: microtubule-associated protein tau
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human MAPT (microtubule-associated protein tau).
Alternative Gene Names
DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND, PPP1R103, tau
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | microtubule-associated protein tau |
| Target Gene | MAPT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000005133 (57%), Mouse ENSMUSG00000018411 (55%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



