CacheBy
Atlas Antibodies Anti-MAP3K4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAP3K4 Antibody

상품 한눈에 보기

Human MAP3K4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 사용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인체 MAP3K4 연구 및 신호전달 경로 분석에 유용합니다.

카탈로그번호
HPA007625-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007625-100 Anti-MAP3K4 Antibody, mitogen-activated protein kinase kinase kinase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007625-25 Anti-MAP3K4 Antibody, mitogen-activated protein kinase kinase kinase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAP3K4 Antibody

Anti-MAP3K4 Antibody

Target Information

  • Target Protein: Mitogen-activated protein kinase kinase kinase 4
  • Target Gene: MAP3K4
  • Alternative Gene Names: KIAA0213, MAPKKK4, MEKK4, MTK1

Product Description

Polyclonal antibody against human MAP3K4, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQDFFLYTARQAIPDIINEILTFKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVSFEQVKRIMELLEYIEALYPSLQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000017419 85%
Mouse ENSMUSG00000014426 82%

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)
Open Datasheet (PDF)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.