CacheBy
Atlas Antibodies Anti-MAP3K2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAP3K2 Antibody

상품 한눈에 보기

Human MAP3K2를 타겟으로 하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human, Rat, Mouse 종에서 반응 확인됨.

카탈로그번호
HPA021540-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021540-100 Anti-MAP3K2 Antibody, mitogen-activated protein kinase kinase kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021540-25 Anti-MAP3K2 Antibody, mitogen-activated protein kinase kinase kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAP3K2 Antibody

Anti-MAP3K2 Antibody

Target: Mitogen-activated protein kinase kinase kinase 2 (MAP3K2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MAP3K2.

Alternative Gene Names

  • MEKK2
  • MEKK2B

Open Datasheet


Target Information

항목 내용
Target Protein Mitogen-activated protein kinase kinase kinase 2
Target Gene MAP3K2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014089 (91%), Mouse ENSMUSG00000024383 (91%)

Antigen Sequence:
IAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMDQM


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.