CacheBy
Atlas Antibodies Anti-MAP3K6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAP3K6 Antibody

상품 한눈에 보기

Human MAP3K6 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 대해 검증되었으며, Rat 및 Mouse에서도 높은 상동성을 보입니다.

카탈로그번호
HPA051192-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051192-100 Anti-MAP3K6 Antibody, mitogen-activated protein kinase kinase kinase 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051192-25 Anti-MAP3K6 Antibody, mitogen-activated protein kinase kinase kinase 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAP3K6 Antibody

Anti-MAP3K6 Antibody

Target: mitogen-activated protein kinase kinase kinase 6
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MAP3K6.


Alternative Gene Names

  • ASK2
  • MAPKKK6
  • MEKK6

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein mitogen-activated protein kinase kinase kinase 6
Target Gene MAP3K6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000008936 (84%), Mouse ENSMUSG00000028862 (81%)

Antigen Sequence:
EEPASPEESSGLSLLHQESKRRAMLAAVLEQELPALAENLHQEQKQEQGARLGRNHVEELLRCLGAHIHTPNRR


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.