Atlas Antibodies Anti-LZTFL1 Antibody

상품 한눈에 보기

Human LZTFL1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보.

카탈로그번호: HPA043466-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043466-100 Anti-LZTFL1 Antibody, leucine zipper transcription factor-like 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043466-25 Anti-LZTFL1 Antibody, leucine zipper transcription factor-like 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-LZTFL1 Antibody

Anti-LZTFL1 Antibody

leucine zipper transcription factor-like 1

Recommended Applications

IHC (Orthogonal validation)
WB (Western Blot)
ICC (Immunocytochemistry)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human LZTFL1

Alternative Gene Names

BBS17

Open Datasheet

Target Information

항목	내용
Target Protein	leucine zipper transcription factor-like 1
Target Gene	LZTFL1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	NTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLN

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000025245	88%
Rat	ENSRNOG00000006244	87%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand