CacheBy
Atlas Antibodies Anti-LYZ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LYZ Antibody

상품 한눈에 보기

Rabbit polyclonal antibody against human lysozyme (LYZ). Validated for IHC and WB with orthogonal validation using RNA-seq data. Affinity purified using PrEST antigen. Supplied in PBS with 40% glycerol and 0.02% sodium azide.

카탈로그번호
HPA048284-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048284-100 Anti-LYZ Antibody, lysozyme 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048284-25 Anti-LYZ Antibody, lysozyme 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LYZ Antibody

Anti-LYZ Antibody

Target: Lysozyme (LYZ)
Type: Polyclonal antibody against Human LYZ


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues
  • WB (Western Blot)

Product Description

Polyclonal antibody raised in rabbit against human lysozyme (LYZ).
Validated for immunohistochemistry and western blot applications.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Lysozyme
Target Gene LYZ
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence WCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCG

Species Reactivity

항목 내용
Verified Species Reactivity Human
Ortholog Identity Mouse (ENSMUSG00000069516, 76%), Rat (ENSRNOG00000034139, 73%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.