
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LYZ Antibody
상품 한눈에 보기
Rabbit polyclonal antibody against human lysozyme (LYZ). Validated for IHC and WB with orthogonal validation using RNA-seq data. Affinity purified using PrEST antigen. Supplied in PBS with 40% glycerol and 0.02% sodium azide.
- 카탈로그번호
- HPA048284-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048284-100 Anti-LYZ Antibody, lysozyme 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048284-25 Anti-LYZ Antibody, lysozyme 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LYZ Antibody
Anti-LYZ Antibody
Target: Lysozyme (LYZ)
Type: Polyclonal antibody against Human LYZ
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues
- WB (Western Blot)
Product Description
Polyclonal antibody raised in rabbit against human lysozyme (LYZ).
Validated for immunohistochemistry and western blot applications.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Lysozyme |
| Target Gene | LYZ |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | WCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCG |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Ortholog Identity | Mouse (ENSMUSG00000069516, 76%), Rat (ENSRNOG00000034139, 73%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



