
원본
Atlas Antibodies Anti-LYZ Antibody
상품 한눈에 보기
Human LYZ(lysozyme) 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. Orthogonal validation으로 검증된 신뢰성 높은 제품. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 보장.
- 카탈로그번호
- HPA066182-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA066182-100 Anti-LYZ Antibody, lysozyme 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066182-25 Anti-LYZ Antibody, lysozyme 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LYZ Antibody
Anti-LYZ Antibody
Target: lysozyme (LYZ)
Type: Polyclonal Antibody against Human LYZ
Validated Applications: IHC, WB
Validation: Orthogonal validation using IHC compared to RNA-seq data in tissues with high and low expression.
Product Description
Polyclonal antibody against human lysozyme (LYZ), validated for immunohistochemistry (IHC) and western blot (WB).
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Lysozyme |
| Target Gene | LYZ |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | WCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCG |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000069516 (76%), Rat ENSRNOG00000034139 (73%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



