CacheBy
Atlas Antibodies Anti-AMPD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AMPD2 Antibody

상품 한눈에 보기

인간 AMPD2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 검증 완료, 설치류와 높은 서열 유사성 보유. 40% 글리세롤 및 PBS 완충액에 저장.

카탈로그번호
HPA027137-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027137-100 Anti-AMPD2 Antibody, adenosine monophosphate deaminase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027137-25 Anti-AMPD2 Antibody, adenosine monophosphate deaminase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AMPD2 Antibody

Anti-AMPD2 Antibody

Target: adenosine monophosphate deaminase 2 (AMPD2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human AMPD2.


Alternative Gene Names

  • SPG63

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein adenosine monophosphate deaminase 2
Target Gene AMPD2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSADAP

Species Reactivity

  • Verified Species: Human
  • Ortholog Identity:
    • Rat ENSRNOG00000019240 (98%)
    • Mouse ENSMUSG00000027889 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.