CacheBy
Atlas Antibodies Anti-AMPD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AMPD2 Antibody

상품 한눈에 보기

Human AMPD2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, 높은 종간 보존성을 보입니다. 연구용으로 adenosine monophosphate deaminase 2 분석에 활용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA045760-100 Anti-AMPD2 Antibody, adenosine monophosphate deaminase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045760-25 Anti-AMPD2 Antibody, adenosine monophosphate deaminase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AMPD2 Antibody

Anti-AMPD2 Antibody

Target: adenosine monophosphate deaminase 2 (AMPD2)
Type: Polyclonal Antibody against Human AMPD2


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human adenosine monophosphate deaminase 2 (AMPD2).


Alternative Gene Names

  • SPG63

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein adenosine monophosphate deaminase 2
Target Gene AMPD2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSADAP
Verified Species Reactivity Human
Interspecies Identity Rat (98%, ENSRNOG00000019240), Mouse (98%, ENSMUSG00000027889)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.