CacheBy
Atlas Antibodies Anti-AMPD3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AMPD3 Antibody

상품 한눈에 보기

Human AMPD3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합합니다. PBS 기반 buffer와 sodium azide 보존제가 포함되어 있습니다.

카탈로그번호
HPA047408-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047408-100 Anti-AMPD3 Antibody, adenosine monophosphate deaminase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047408-25 Anti-AMPD3 Antibody, adenosine monophosphate deaminase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AMPD3 Antibody

Anti-AMPD3 Antibody

Target: adenosine monophosphate deaminase 3 (AMPD3)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human AMPD3

Open Datasheet


Target Information

항목 내용
Target Protein adenosine monophosphate deaminase 3
Target Gene AMPD3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDLETYTVDMSHILALITDGPTKTYCHRRLNFLES

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000005686 89%
Rat ENSRNOG00000018262 89%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 농도 / 비율
Glycerol 40%
PBS (pH 7.2) Base buffer
Sodium Azide 0.02% (preservative)

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.