CacheBy
Atlas Antibodies Anti-ALOX15B Antibody
원본

Atlas Antibodies Anti-ALOX15B Antibody

상품 한눈에 보기

Human ALOX15B 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 ICC 응용에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 고품질 항체. PrEST 항원을 이용한 Affinity purification으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA010562-100 Anti-ALOX15B Antibody, arachidonate 15-lipoxygenase, type B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010562-25 Anti-ALOX15B Antibody, arachidonate 15-lipoxygenase, type B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALOX15B Antibody

Anti-ALOX15B Antibody

arachidonate 15-lipoxygenase, type B


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human ALOX15B


Alternative Gene Names

15-LOX-2

Open Datasheet


Target Information

항목 내용
Target Protein arachidonate 15-lipoxygenase, type B
Target Gene ALOX15B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020891 (73%), Rat ENSRNOG00000007778 (73%)

Antigen Sequence:
FRAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWAD


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.