CacheBy
Atlas Antibodies Anti-ALOX12B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALOX12B Antibody

상품 한눈에 보기

인간 ALOX12B 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 적용에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 정제되었습니다. 높은 종간 서열 유사성을 가진 신뢰성 높은 연구용 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA024002-100 Anti-ALOX12B Antibody, arachidonate 12-lipoxygenase, 12R type 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024002-25 Anti-ALOX12B Antibody, arachidonate 12-lipoxygenase, 12R type 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALOX12B Antibody

Anti-ALOX12B Antibody

Target Protein: arachidonate 12-lipoxygenase, 12R type
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ALOX12B.


Alternative Gene Names

  • 12R-LOX

Open Datasheet


Target Information

항목 내용
Target Protein arachidonate 12-lipoxygenase, 12R type
Target Gene ALOX12B
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000022210 (84%), Mouse ENSMUSG00000032807 (84%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEI

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.