CacheBy
Atlas Antibodies Anti-ALOX12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALOX12 Antibody

상품 한눈에 보기

Human ALOX12 단백질에 특이적인 폴리클로날 항체로, Rabbit에서 생산됨. WB 및 IHC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA064819-100 Anti-ALOX12 Antibody, arachidonate 12-lipoxygenase, 12S type 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064819-25 Anti-ALOX12 Antibody, arachidonate 12-lipoxygenase, 12S type 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALOX12 Antibody

Anti-ALOX12 Antibody

Target Protein: arachidonate 12-lipoxygenase
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human ALOX12 (arachidonate 12-lipoxygenase).


Alternative Gene Names

  • 12S-LOX

Open Datasheet (PDF)


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

YAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEY

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity (%)
Mouse ENSMUSG00000000320 80%
Rat ENSRNOG00000027037 79%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.