CacheBy
Atlas Antibodies Anti-LTA4H Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LTA4H Antibody

상품 한눈에 보기

인간 LTA4H 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, 독립 항체 검증으로 신뢰성 확보. 프리스트 항원 기반 친화 정제. 40% 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017017-100 Anti-LTA4H Antibody, leukotriene A4 hydrolase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017017-25 Anti-LTA4H Antibody, leukotriene A4 hydrolase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LTA4H Antibody

Anti-LTA4H Antibody

Target: leukotriene A4 hydrolase
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Independent antibody validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human LTA4H.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein leukotriene A4 hydrolase
Target Gene LTA4H
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGET
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000004494 (95%), Mouse ENSMUSG00000015889 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.