
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LTA4H Antibody
상품 한눈에 보기
인간 LTA4H 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, 독립 항체 검증으로 신뢰성 확보. 프리스트 항원 기반 친화 정제. 40% 글리세롤 및 PBS 완충액에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA017017-100 Anti-LTA4H Antibody, leukotriene A4 hydrolase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017017-25 Anti-LTA4H Antibody, leukotriene A4 hydrolase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LTA4H Antibody
Anti-LTA4H Antibody
Target: leukotriene A4 hydrolase
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Independent antibody validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human LTA4H.
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leukotriene A4 hydrolase |
| Target Gene | LTA4H |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGET |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000004494 (95%), Mouse ENSMUSG00000015889 (95%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



