AI 생성

1 / 2

Atlas Antibodies Anti-LTB4R2 Antibody

상품 한눈에 보기

Human LTB4R2(Leukotriene B4 receptor 2)를 인식하는 Rabbit Polyclonal 항체로, Affinity purified 제품입니다. IHC 등 다양한 응용에 적합하며, 고순도 및 높은 특이성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA072921-100 Anti-LTB4R2 Antibody, leukotriene B4 receptor 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA072921-25 Anti-LTB4R2 Antibody, leukotriene B4 receptor 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: leukotriene B4 receptor 2 (LTB4R2)
Supplier: Atlas Antibodies

Polyclonal antibody against human LTB4R2.

BLT2, BLTR2, JULF2, NOP9

항목	내용
Target Protein	leukotriene B4 receptor 2
Target Gene	LTB4R2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000025727 (38%), Rat ENSRNOG00000020382 (37%)

Antigen Sequence:

MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSR

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.