CacheBy
Atlas Antibodies Anti-LTA4H Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LTA4H Antibody

상품 한눈에 보기

Human LTA4H 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC 실험에 적합합니다. PrEST 항원으로 특이적으로 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008399-100 Anti-LTA4H Antibody, leukotriene A4 hydrolase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008399-25 Anti-LTA4H Antibody, leukotriene A4 hydrolase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LTA4H Antibody

Anti-LTA4H Antibody

Target: leukotriene A4 hydrolase (LTA4H)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human leukotriene A4 hydrolase (LTA4H).
Validated for use in Western blot (WB) and immunohistochemistry (IHC).

Open Datasheet (PDF)


Validation

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:

ALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGET

Species Reactivity

Species Reactivity Sequence Identity
Human Verified -
Mouse Predicted 95%
Rat Predicted 95%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Affinity purified using the PrEST antigen as affinity ligand
Storage/Handling Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
MSDS Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Application
WB Application
Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.