CacheBy
Atlas Antibodies Anti-LRRIQ1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRIQ1 Antibody

상품 한눈에 보기

휴먼 LRRIQ1 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합. 토끼에서 생산된 IgG 항체이며 PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며, 버퍼는 40% 글리세롤 및 PBS(pH 7.2) 기반.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046162-100 Anti-LRRIQ1 Antibody, leucine-rich repeats and IQ motif containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046162-25 Anti-LRRIQ1 Antibody, leucine-rich repeats and IQ motif containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRIQ1 Antibody

Anti-LRRIQ1 Antibody

Target: Leucine-rich repeats and IQ motif containing 1 (LRRIQ1)
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 응용에 적합


Product Description

Polyclonal antibody against human LRRIQ1 protein.


Alternative Gene Names

FLJ12303, KIAA1801

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Leucine-rich repeats and IQ motif containing 1
Target Gene LRRIQ1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQTLKAQRDREEKQFQEEEEKR

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Identity
Rat ENSRNOG00000004564 63%
Mouse ENSMUSG00000019892 58%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험별로 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.