Atlas Antibodies Anti-LRRN1 Antibody

상품 한눈에 보기

Human LRRN1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인체 단백질 발현 분석 및 신경 관련 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011071-100 Anti-LRRN1 Antibody, leucine rich repeat neuronal 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011071-25 Anti-LRRN1 Antibody, leucine rich repeat neuronal 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: leucine rich repeat neuronal 1 (LRRN1)
Supplier: Atlas Antibodies

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Recombinant Expression Validation: Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human LRRN1

항목	내용
Target Protein	leucine rich repeat neuronal 1
Target Gene	LRRN1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000034648 (94%), Rat ENSRNOG00000006802 (94%)

Antigen Sequence:

NSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSEQCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSSEGTLEISNIQIEDSGRYTCVAQNVQGAD

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand