Atlas Antibodies Anti-LRRIQ4 Antibody

상품 한눈에 보기

Human LRRIQ4 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. ICC 등 다양한 연구 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 반응성이 검증되었으며, LRRC64로도 알려진 유전자 타겟을 인식합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036271-100 Anti-LRRIQ4 Antibody, leucine rich repeats and IQ motif containing 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036271-25 Anti-LRRIQ4 Antibody, leucine rich repeats and IQ motif containing 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-LRRIQ4 Antibody

Anti-LRRIQ4 Antibody

Target: leucine rich repeats and IQ motif containing 4 (LRRIQ4)
Alternative Gene Name: LRRC64
Supplier: Atlas Antibodies

Recommended Applications

이미지에 표시된 텍스트: ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human LRRIQ4

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:

TDLKEIPVVIFKNLHHLELLGLTGNHLKCLPKEIVNQTKLREIYLKRNQFEVFPQELCVLYTLEIIDLDENKIGAIPEEIGHLTGLQKFYMASNNL

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000027703	71%
Rat	ENSRNOG00000009004	70%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand