CacheBy
Atlas Antibodies Anti-LRRD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRD1 Antibody

상품 한눈에 보기

Human LRRD1 단백질을 표적하는 고품질 폴리클로날 항체로, IHC Orthogonal 검증을 통해 단백질 발현 확인 가능. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제됨. 인간 시료에 적합하며 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA079440-100 Anti-LRRD1 Antibody, leucine rich repeats and death domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA079440-25 Anti-LRRD1 Antibody, leucine rich repeats and death domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRD1 Antibody

Anti-LRRD1 Antibody

Target: leucine rich repeats and death domain containing 1 (LRRD1)
Supplier: Atlas Antibodies


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human LRRD1


Alternative Gene Names

LRRD1


Target Information

항목 내용
Target Protein leucine rich repeats and death domain containing 1
Target Gene LRRD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000026196 (75%), Mouse ENSMUSG00000040367 (70%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

NLTALPSAIYNIFSLKEINFDDNPLLRPPVEICKGKQLYTIARYLQRADERDGRLK

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.