
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRRD1 Antibody
상품 한눈에 보기
Human LRRD1 단백질을 표적하는 고품질 폴리클로날 항체로, IHC Orthogonal 검증을 통해 단백질 발현 확인 가능. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제됨. 인간 시료에 적합하며 높은 특이성과 재현성을 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA079440-100 Anti-LRRD1 Antibody, leucine rich repeats and death domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA079440-25 Anti-LRRD1 Antibody, leucine rich repeats and death domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRRD1 Antibody
Anti-LRRD1 Antibody
Target: leucine rich repeats and death domain containing 1 (LRRD1)
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human LRRD1
Alternative Gene Names
LRRD1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeats and death domain containing 1 |
| Target Gene | LRRD1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000026196 (75%), Mouse ENSMUSG00000040367 (70%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
NLTALPSAIYNIFSLKEINFDDNPLLRPPVEICKGKQLYTIARYLQRADERDGRLKNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



