CacheBy
Atlas Antibodies Anti-LRRC55 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC55 Antibody

상품 한눈에 보기

인간 LRRC55 단백질을 인식하는 폴리클로날 항체입니다. 토끼 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증되었고, IHC 등 다양한 응용에 적합합니다. PBS/glycerol 완충액에 보존제가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014053-100 Anti-LRRC55 Antibody, leucine rich repeat containing 55 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014053-25 Anti-LRRC55 Antibody, leucine rich repeat containing 55 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC55 Antibody

Anti-LRRC55 Antibody

Target: leucine rich repeat containing 55 (LRRC55)
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human LRRC55


Alternative Gene Names

  • FLJ45686

Open Datasheet


Target Information

항목 내용
Target Protein leucine rich repeat containing 55
Target Gene LRRC55
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Ortholog Identity Mouse (96%), Rat (96%)

Antigen Sequence:
RLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQ


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.