Atlas Antibodies Anti-LRRC56 Antibody

상품 한눈에 보기

사람 LRRC56 단백질을 인식하는 폴리클로날 항체로, 다양한 연구용 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증되었으며, 40% 글리세롤 PBS 완충액에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038728-100 Anti-LRRC56 Antibody, leucine rich repeat containing 56 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038728-25 Anti-LRRC56 Antibody, leucine rich repeat containing 56 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Leucine Rich Repeat Containing 56 (LRRC56)
Supplier: Atlas Antibodies

Polyclonal antibody against human LRRC56.

항목	내용
Target Protein	Leucine rich repeat containing 56
Target Gene	LRRC56
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000038637 (77%), Rat ENSRNOG00000016697 (77%)

HNPCPQSKGPGSQRDRLGEQLVEEYLSPARLQALARVDDLRLVRTLEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWLARCGLADLDGI

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)