Atlas Antibodies Anti-LRRC53 Antibody

상품 한눈에 보기

Human LRRC53 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 완충액에 보존. 인체 반응성이 검증된 고품질 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054062-100 Anti-LRRC53 Antibody, leucine rich repeat containing 53 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054062-25 Anti-LRRC53 Antibody, leucine rich repeat containing 53 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: leucine rich repeat containing 53 (LRRC53)

Polyclonal antibody against human LRRC53.
Affinity purified using the PrEST antigen as affinity ligand.

항목	내용
Target Gene	LRRC53
Target Protein	leucine rich repeat containing 53
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	VDLSRNRLAHMPDVFTPLKQLILLSLDKNQWSCTCDLHPLARFLRNYIKSSAHTLRNAKDLNCQPSTAAVAAAQSVLRLSETNCDSKAPNFTLVL
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000009646 (29%), Mouse ENSMUSG00000051228 (29%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet