Atlas Antibodies Anti-LRRC47 Antibody

상품 한눈에 보기

인간 LRRC47 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며 독립 항체 검증으로 신뢰성 확보. 토끼 유래 IgG 형식으로 정제된 PrEST 항원 기반 생산.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA012018-100 Anti-LRRC47 Antibody, leucine rich repeat containing 47 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA012018-25 Anti-LRRC47 Antibody, leucine rich repeat containing 47 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Leucine Rich Repeat Containing 47 (LRRC47)
Supplier: Atlas Antibodies

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC: Immunocytochemistry application supported.

Polyclonal antibody against Human LRRC47.

KIAA1185, RP1-286D6.3

항목	내용
Target Protein	Leucine Rich Repeat Containing 47
Target Gene	LRRC47
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000024796 (91%), Mouse ENSMUSG00000029028 (91%)

PGNALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEK

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand