AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRRC38 Antibody
상품 한눈에 보기
Human LRRC38 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 높은 특이성을 제공합니다. PBS와 글리세롤 기반 버퍼에 보존제를 포함하고 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038778-100 Anti-LRRC38 Antibody, leucine rich repeat containing 38 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038778-25 Anti-LRRC38 Antibody, leucine rich repeat containing 38 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRRC38 Antibody
Anti-LRRC38 Antibody
Target: leucine rich repeat containing 38 (LRRC38)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human LRRC38.
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeat containing 38 |
| Target Gene | LRRC38 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NNLVGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRSLRLDGNPWLCDCDFAHLFSWIQENASKLPK |
Species Reactivity
- Verified: Human
- Orthologs with high identity:
- Rat ENSRNOG00000015264 (89%)
- Mouse ENSMUSG00000097351 (88%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.