
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRRC18 Antibody
상품 한눈에 보기
Human LRRC18 단백질을 타깃으로 하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증된 신뢰성 높은 항체로, RNA-seq 데이터 및 재조합 단백질 발현을 통한 정교한 검증 수행. Affinity purification 방식으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039256-100 Anti-LRRC18 Antibody, leucine rich repeat containing 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039256-25 Anti-LRRC18 Antibody, leucine rich repeat containing 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRRC18 Antibody
Anti-LRRC18 Antibody
Target: leucine rich repeat containing 18 (LRRC18)
Supplier: Atlas Antibodies
Recommended Applications
IHC (Orthogonal Validation):
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Recombinant Expression Validation):
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human LRRC18
Alternative Gene Names
MGC34773, UNQ933, UNQ9338, VKGE9338
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeat containing 18 |
| Target Gene | LRRC18 |
| Antigen Sequence | IFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000041673 (64%), Rat ENSRNOG00000020080 (64%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



