Atlas Antibodies Anti-LRRC18 Antibody

상품 한눈에 보기

Human LRRC18 단백질을 타깃으로 하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증된 신뢰성 높은 항체로, RNA-seq 데이터 및 재조합 단백질 발현을 통한 정교한 검증 수행. Affinity purification 방식으로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039256-100 Anti-LRRC18 Antibody, leucine rich repeat containing 18 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039256-25 Anti-LRRC18 Antibody, leucine rich repeat containing 18 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: leucine rich repeat containing 18 (LRRC18)
Supplier: Atlas Antibodies

IHC (Orthogonal Validation):
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant Expression Validation):
Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human LRRC18

MGC34773, UNQ933, UNQ9338, VKGE9338

항목	내용
Target Protein	leucine rich repeat containing 18
Target Gene	LRRC18
Antigen Sequence	IFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRL
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000041673 (64%), Rat ENSRNOG00000020080 (64%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.