CacheBy
Atlas Antibodies Anti-LRIT3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRIT3 Antibody

상품 한눈에 보기

Human LRIT3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. 인간 반응성이 검증되었으며, LRIT3 관련 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA013454-100 Anti-LRIT3 Antibody, leucine-rich repeat, immunoglobulin-like and transmembrane domains 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013454-25 Anti-LRIT3 Antibody, leucine-rich repeat, immunoglobulin-like and transmembrane domains 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRIT3 Antibody

Anti-LRIT3 Antibody

Target: leucine-rich repeat, immunoglobulin-like and transmembrane domains 3 (LRIT3)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human LRIT3.

Alternative Gene Names

CSNB1F, FIGLER4, FLJ44691

Open Datasheet

Target Information

  • Target Protein: leucine-rich repeat, immunoglobulin-like and transmembrane domains 3
  • Target Gene: LRIT3

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NPWFCDCHISKMIELSKVVDPAIVLLDPLMTCSEPERLTGILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQITWTRSDSSPVNYTVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000093865 84%
Rat ENSRNOG00000061097 83%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.