
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRG1 Antibody
상품 한눈에 보기
인간 LRG1 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 WB 등 다양한 응용에 적합하며, RNA-seq 데이터 기반의 정교한 Orthogonal 검증 제공. 친화 정제된 고품질 Rabbit IgG 항체로 높은 특이성과 재현성 확보.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001889-100 Anti-LRG1 Antibody, leucine-rich alpha-2-glycoprotein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001889-25 Anti-LRG1 Antibody, leucine-rich alpha-2-glycoprotein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRG1 Antibody
Anti-LRG1 Antibody
Target Protein: leucine-rich alpha-2-glycoprotein 1
Alternative Gene Names: LRG
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal antibody against Human LRG1.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine-rich alpha-2-glycoprotein 1 |
| Target Gene | LRG1 |
| Alternative Gene Names | LRG |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000037095 (63%), Rat ENSRNOG00000049918 (61%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSG |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Related Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



