CacheBy
Atlas Antibodies Anti-LRG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRG1 Antibody

상품 한눈에 보기

Human LRG1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. Affinity purification으로 높은 특이성과 재현성 확보. PBS/glycerol buffer에 보존되어 안정적.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001888-100 Anti-LRG1 Antibody, leucine-rich alpha-2-glycoprotein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001888-25 Anti-LRG1 Antibody, leucine-rich alpha-2-glycoprotein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRG1 Antibody

Anti-LRG1 Antibody

Target: leucine-rich alpha-2-glycoprotein 1 (LRG1)
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human LRG1


Alternative Gene Names

  • LRG

Open Datasheet


Specifications

항목 내용
Target Protein leucine-rich alpha-2-glycoprotein 1
Target Gene LRG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000037095 (63%), Rat ENSRNOG00000049918 (61%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSG

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.