
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRFN4 Antibody
상품 한눈에 보기
Human LRFN4 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal Validation 제공. Rabbit 호스트, IgG 아이소타입, PrEST 항원으로 정제. 인체 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA077570-100 Anti-LRFN4 Antibody, leucine rich repeat and fibronectin type III domain containing 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077570-25 Anti-LRFN4 Antibody, leucine rich repeat and fibronectin type III domain containing 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRFN4 Antibody
Anti-LRFN4 Antibody
Target: leucine rich repeat and fibronectin type III domain containing 4 (LRFN4)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human LRFN4
Alternative Gene Names
FIGLER6, MGC3103, SALM3
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeat and fibronectin type III domain containing 4 |
| Target Gene | LRFN4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GEGTLESEPAVQVTEVTATSGLVSWGPGRPADPVWMFQIQYNSSEDETLIYRIVPASSHHFLLKHLVPGADYDLC |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000045045 (99%), Rat ENSRNOG00000019356 (99%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



