CacheBy
Atlas Antibodies Anti-LINGO3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LINGO3 Antibody

상품 한눈에 보기

Human LINGO3 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. 면역세포 화학(ICC) 등 다양한 응용에 적합합니다. LERN2, LRRN6B 등 대체 유전자명과 교차 반응 정보 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043781-100 Anti-LINGO3 Antibody, leucine rich repeat and Ig domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043781-25 Anti-LINGO3 Antibody, leucine rich repeat and Ig domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LINGO3 Antibody

Anti-LINGO3 Antibody

Target Information

  • Target Protein: leucine rich repeat and Ig domain containing 3
  • Target Gene: LINGO3
  • Alternative Gene Names: LERN2, LRRN6B

Product Description

Polyclonal Antibody against Human LINGO3

면역세포 화학 (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCR

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000051067 (94%)
  • Rat ENSRNOG00000032569 (94%)

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.