
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LIN28A Antibody
상품 한눈에 보기
Human LIN28A 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification 방식으로 정제되었으며, 인간 LIN28A에 특이적으로 반응합니다. ICC 등 다양한 연구용 응용에 적합합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA068814-100 Anti-LIN28A Antibody, lin-28 homolog A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068814-25 Anti-LIN28A Antibody, lin-28 homolog A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LIN28A Antibody
Anti-LIN28A Antibody
Target Information
- Target Protein: lin-28 homolog A
- Target Gene: LIN28A
- Alternative Gene Names: CSDD1, FLJ12457, LIN-28, LIN28, ZCCHC1
Product Description
Polyclonal Antibody against Human LIN28A.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:KCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000060320 (96%)
- Mouse ENSMUSG00000050966 (92%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Recommended Applications
Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
Open Datasheet (PDF)
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



