CacheBy
Atlas Antibodies Anti-LIN28A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LIN28A Antibody

상품 한눈에 보기

Human LIN28A 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification 방식으로 정제되었으며, 인간 LIN28A에 특이적으로 반응합니다. ICC 등 다양한 연구용 응용에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068814-100 Anti-LIN28A Antibody, lin-28 homolog A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068814-25 Anti-LIN28A Antibody, lin-28 homolog A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LIN28A Antibody

Anti-LIN28A Antibody

Target Information

  • Target Protein: lin-28 homolog A
  • Target Gene: LIN28A
  • Alternative Gene Names: CSDD1, FLJ12457, LIN-28, LIN28, ZCCHC1

Product Description

Polyclonal Antibody against Human LIN28A.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
KCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000060320 (96%)
  • Mouse ENSMUSG00000050966 (92%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)
Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.