AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LIN28B Antibody
상품 한눈에 보기
Human LIN28B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합. RNA-seq 데이터와의 정합으로 직교 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 높은 특이성을 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA061745-100 Anti-LIN28B Antibody, lin-28 homolog B (C. elegans) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061745-25 Anti-LIN28B Antibody, lin-28 homolog B (C. elegans) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LIN28B Antibody
Anti-LIN28B Antibody
Target: lin-28 homolog B (C. elegans)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human LIN28B.
Alternative Gene Names
CSDD2, FLJ16517
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | lin-28 homolog B (C. elegans) |
| Target Gene | LIN28B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQ |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000025938 (87%), Mouse ENSMUSG00000063804 (85%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.