CacheBy
Atlas Antibodies Anti-LIMS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LIMS1 Antibody

상품 한눈에 보기

Human LIMS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PINCH/PINCH1 유전자 대체명으로도 알려짐. PrEST 항원을 이용한 친화 정제 방식. 사람에 대한 반응성이 검증됨.

카탈로그번호
HPA058455-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058455-100 Anti-LIMS1 Antibody, LIM and senescent cell antigen-like domains 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058455-25 Anti-LIMS1 Antibody, LIM and senescent cell antigen-like domains 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LIMS1 Antibody

Anti-LIMS1 Antibody

LIM and senescent cell antigen-like domains 1

면역조직화학(IHC) 등 다양한 연구 응용에 적합

Product Description

Polyclonal Antibody against Human LIMS1

Alternative Gene Names

PINCH, PINCH1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein LIM and senescent cell antigen-like domains 1
Target Gene LIMS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000019920 (84%), Rat ENSRNOG00000037765 (80%)

Antigen Sequence:

MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVY

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험에 맞게 조정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.