CacheBy
Atlas Antibodies Anti-LIMS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LIMS1 Antibody

상품 한눈에 보기

Human LIMS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PINCH/PINCH1 유전자의 단백질 검출에 사용되며, PrEST 항원으로 친화 정제되었습니다. PBS와 글리세롤 완충액에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061230-100 Anti-LIMS1 Antibody, LIM and senescent cell antigen-like domains 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061230-25 Anti-LIMS1 Antibody, LIM and senescent cell antigen-like domains 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LIMS1 Antibody

Anti-LIMS1 Antibody

LIM and senescent cell antigen-like domains 1

면역조직화학(IHC) 등 다양한 응용에 적합

Product Description

Polyclonal Antibody against Human LIMS1

Alternative Gene Names

PINCH, PINCH1

Open Datasheet

Target Information

항목 내용
Target Protein LIM and senescent cell antigen-like domains 1
Target Gene LIMS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVY
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000019920 (84%), Rat ENSRNOG00000037765 (80%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.